Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT, Human (His)

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

FHIT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fhit-protein-human-his.html

Purity

98.00

Smiles

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Molecular Formula

2272 (Gene_ID) P49789 (M1-Q147) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLT8D1 Antibody (HRP)
abx307526-01 20 µg

GLT8D1 Antibody (HRP)

Sign In for Pricing
View Details
GLT8D1 Antibody (HRP)
abx307526-02 50 µg

GLT8D1 Antibody (HRP)

Sign In for Pricing
View Details
GLT8D1 Antibody (HRP)
abx307526-03 100 µg

GLT8D1 Antibody (HRP)

Sign In for Pricing
View Details
GLT8D1 Antibody (HRP)
abx307526-04 200 µg

GLT8D1 Antibody (HRP)

Sign In for Pricing
View Details
GLT8D1 Antibody (HRP)
abx307526-05 1 mg

GLT8D1 Antibody (HRP)

Sign In for Pricing
View Details
MEK1 / 2 (pS217) Antibody
abx011762 100 µg

MEK1 / 2 (pS217) Antibody

Sign In for Pricing
View Details