Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT, Human (His)

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

FHIT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fhit-protein-human-his.html

Purity

98.00

Smiles

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Molecular Formula

2272 (Gene_ID) P49789 (M1-Q147) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOS siRNA (Human)
MBS8218001-01 15 nmol

MOS siRNA (Human)

Sign In for Pricing
View Details
MOS siRNA (Human)
MBS8218001-02 30 nmol

MOS siRNA (Human)

Sign In for Pricing
View Details
MOS siRNA (Human)
MBS8218001-03 5x 30 nmol

MOS siRNA (Human)

Sign In for Pricing
View Details
rno??miR-190b miRNA Inhibitor
MIR01220 2x 5.0 nmol

rno??miR-190b miRNA Inhibitor

Sign In for Pricing
View Details
Ran (NM_053439) Rat Untagged Clone
RN210091 10 µg

Ran (NM_053439) Rat Untagged Clone

Sign In for Pricing
View Details
COL11A2P Protein Vector (Human) (pPB-N-His)
PV070278 500 ng

COL11A2P Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details