Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT, Human (His)

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

FHIT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fhit-protein-human-his.html

Purity

98.00

Smiles

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Molecular Formula

2272 (Gene_ID) P49789 (M1-Q147) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398872-01 48 Well

Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Ask
View Details
Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398872-02 96 Well

Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Ask
View Details
Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398872-03 5x 96 Well

Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Ask
View Details
Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398872-04 10x 96 Well

Canine Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Ask
View Details
Lentiviral human HFM1 sgRNA gene knockout kit - Lentiviral human HFM1 sgRNA gene knockout kit (25)
GTR15358818 1 Vial

Lentiviral human HFM1 sgRNA gene knockout kit - Lentiviral human HFM1 sgRNA gene knockout kit (25)

Ask
View Details
Recombinant Human KRAS/K-Ras 2 Protein, C-His & C-Avi
MBS1576196-01 0.1 mg

Recombinant Human KRAS/K-Ras 2 Protein, C-His & C-Avi

Ask
View Details