Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT, Human (His)

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

FHIT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fhit-protein-human-his.html

Purity

98.00

Smiles

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Molecular Formula

2272 (Gene_ID) P49789 (M1-Q147) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (FITC)
135650-FITC 100 µL

ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (FITC)

Ask
View Details
Desmin protein (Chicken)
30R-AD003 250 ug

Desmin protein (Chicken)

Ask
View Details
Porcine soluble P-selectin, s-SELP ELISA KIT
E0219Po-01 48 Well

Porcine soluble P-selectin, s-SELP ELISA KIT

Ask
View Details
Porcine soluble P-selectin, s-SELP ELISA KIT
E0219Po-02 96 Well

Porcine soluble P-selectin, s-SELP ELISA KIT

Ask
View Details
Porcine soluble P-selectin, s-SELP ELISA KIT
E0219Po-03 5x 96 Tests

Porcine soluble P-selectin, s-SELP ELISA KIT

Ask
View Details
Porcine soluble P-selectin, s-SELP ELISA KIT
E0219Po-04 10x 96 Tests

Porcine soluble P-selectin, s-SELP ELISA KIT

Ask
View Details