Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT, Human (His)

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

FHIT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fhit-protein-human-his.html

Purity

98.00

Smiles

MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Molecular Formula

2272 (Gene_ID) P49789 (M1-Q147) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Epb41l4a (NM_001107397) Rat Tagged Lenti ORF Clone
RR203881L3 10 µg

Epb41l4a (NM_001107397) Rat Tagged Lenti ORF Clone

Ask
View Details
Lymphotoxin Beta Receptor (LTBR) Antibody
abx113553 100 µL

Lymphotoxin Beta Receptor (LTBR) Antibody

Ask
View Details
Lentiviral human MYRF shRNA (UAS) - Lentiviral human MYRF shRNA (UAS, iRFP) plasmid
GTR15321379 1 Vial

Lentiviral human MYRF shRNA (UAS) - Lentiviral human MYRF shRNA (UAS, iRFP) plasmid

Ask
View Details
Lentiviral human OR2K2 sgRNA gene knockout kit - Lentiviral human OR2K2 sgRNA gene knockout kit (100)
GTR15397579 1 Vial

Lentiviral human OR2K2 sgRNA gene knockout kit - Lentiviral human OR2K2 sgRNA gene knockout kit (100)

Ask
View Details
MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5, MAP Kinase-activated Protein Kinase 5, MAPK-activated Protein Kinase 5, MAPKAP Kinase 5, MAPKAPK-5, p38-regulated/activated Protein Kinase, PRAK) (PE)
129418-PE 100 µL

MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5, MAP Kinase-activated Protein Kinase 5, MAPK-activated Protein Kinase 5, MAPKAP Kinase 5, MAPKAPK-5, p38-regulated/activated Protein Kinase, PRAK) (PE)

Ask
View Details