Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase NRas (NRAS)

Product Specifications

Product Name Alternative

Transforming protein N-Ras

Abbreviation

Recombinant Human NRAS protein

Gene Name

NRAS

UniProt

P01111

Expression Region

1-186aa

Organism

Homo sapiens (Human)

Target Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.1 kDa

References & Citations

"Structure and activation of the human N-ras gene." Taparowsky E., Shimizu K., Goldfarb M., Wigler M. Cell 34:581-586 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-ZEBOV GP/Glycoprotein (ANP-015)
DVV03608 100 μg

Research Grade Anti-ZEBOV GP/Glycoprotein (ANP-015)

Sign In for Pricing
View Details
Rabbit Polyclonal OCIAD2 Antibody
NBP2-95152-0.1mL 0.1 mL

Rabbit Polyclonal OCIAD2 Antibody

Sign In for Pricing
View Details
SBSN, NT (SBSN, Suprabasin) (MaxLight 405)
MBS6345134-01 0.1 mL

SBSN, NT (SBSN, Suprabasin) (MaxLight 405)

Sign In for Pricing
View Details
SBSN, NT (SBSN, Suprabasin) (MaxLight 405)
MBS6345134-02 5x 0.1 mL

SBSN, NT (SBSN, Suprabasin) (MaxLight 405)

Sign In for Pricing
View Details
Sentrin-specific Protease 6 (SENP6) Human ELISA Kit
G9570 96 Tests

Sentrin-specific Protease 6 (SENP6) Human ELISA Kit

Sign In for Pricing
View Details
Matrix Metalloproteinase 8, CT (Matrix Metallopeptidase 8 (Neutrophil Collagenase), MMP-8, MMP8, CLG1, HNC, Neutrophil Collagenase, PMNL Collagenase, PMNL-CL) (PE) discontinued
M2424-05D-PE 100 µL

Matrix Metalloproteinase 8, CT (Matrix Metallopeptidase 8 (Neutrophil Collagenase), MMP-8, MMP8, CLG1, HNC, Neutrophil Collagenase, PMNL Collagenase, PMNL-CL) (PE) discontinued

Sign In for Pricing
View Details