Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Junin mammarenavirus Pre-glycoprotein polyprotein GP complex (GPC), partial

Product Specifications

Product Name Alternative

(Pre-GP-C)

Abbreviation

Recombinant Junin mammarenavirus GPC protein, partial

Gene Name

GPC

UniProt

P26313

Expression Region

59-251aa

Organism

Junin mammarenavirus (JUNV) (Junn mammarenavirus)

Target Sequence

EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSLK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

[Glycoprotein G2]: Class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome.; Stable signal peptide (SSP) : cleaved and functions as a signal peptide. In addition, it is also retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational maturation cleavage of GP1 and GP2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.; [Glycoprotein G1]: Interacts with the host receptor. Mediates virus attachment to host TFRC. This attachment induces virion internalization predominantly through clathrin-mediated endocytosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.8 kDa

References & Citations

"Involvement of cellular proteins in Junin arenavirus entry." Martinez M.G., Forlenza M.B., Candurra N.A. Biotechnol. J. 4:866-870 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Depp1 Mouse Gene Knockout Kit (CRISPR)
KN500498 1 Kit

Depp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant HJURP Antibody
RC-5745-01 50 μL

Recombinant HJURP Antibody

Sign In for Pricing
View Details
Recombinant HJURP Antibody
RC-5745-02 100 µL

Recombinant HJURP Antibody

Sign In for Pricing
View Details
Recombinant HJURP Antibody
RC-5745-03 1 mL

Recombinant HJURP Antibody

Sign In for Pricing
View Details
SMARCE1 Rabbit Polyclonal Antibody
TA381767 100 µL

SMARCE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Na-Boc-D-histidine
TRC-B656220-10G 10 g

Na-Boc-D-histidine

Sign In for Pricing
View Details