Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTACK/CCL27, Mouse

CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CTACK/CCL27 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctack-ccl27-protein-mouse.html

Purity

98.00

Smiles

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN

Molecular Formula

20301 (Gene_ID) NP_035466 (L26-N120) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal mGluR2 Antibody (455310) [Alexa Fluor 594]
FAB4676T 0.1 mL

Mouse Monoclonal mGluR2 Antibody (455310) [Alexa Fluor 594]

Sign In for Pricing
View Details
HS1 Antibody
CST 4503S 100 µL

HS1 Antibody

Sign In for Pricing
View Details
SIVA (SIVA1) (NM_006427) Human Tagged ORF Clone
RG215680 10 µg

SIVA (SIVA1) (NM_006427) Human Tagged ORF Clone

Sign In for Pricing
View Details
Decylubiquinone
sc-358659A 50 mg

Decylubiquinone

Sign In for Pricing
View Details
Interleukin 37 (IL37) Antibody
abx320563-01 20 µL

Interleukin 37 (IL37) Antibody

Sign In for Pricing
View Details
Interleukin 37 (IL37) Antibody
abx320563-02 50 µL

Interleukin 37 (IL37) Antibody

Sign In for Pricing
View Details