Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 10 (CXCL10)

Product Specifications

Product Name Alternative

10KDA interferon gamma-induced protein ; Gamma-IP10 ; IP-10Small-inducible cytokine B10

Abbreviation

Recombinant Human CXCL10 protein

Gene Name

CXCL10

UniProt

P02778

Expression Region

22-98aa

Organism

Homo sapiens (Human)

Target Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Molecular Weight

12.6 kDa

References & Citations

Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P.Eur. J. Biochem. 268:4992-4999 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROBO2 3'UTR GFP Stable Cell Line
TU070352 1.0 mL

ROBO2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SYDE2-set siRNA/shRNA/RNAi Lentivector (Human)
45952091 4x 500 ng

SYDE2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Peptidase B (pepB)
MBS1092521-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 18 Peptidase B (pepB)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Peptidase B (pepB)
MBS1092521-02 0.02 mg (Yeast)

Recombinant Shigella boydii serotype 18 Peptidase B (pepB)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Peptidase B (pepB)
MBS1092521-03 0.1 mg (E-Coli)

Recombinant Shigella boydii serotype 18 Peptidase B (pepB)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 Peptidase B (pepB)
MBS1092521-04 0.1 mg (Yeast)

Recombinant Shigella boydii serotype 18 Peptidase B (pepB)

Sign In for Pricing
View Details