Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae P30 adhesin (p30)

Product Specifications

Product Name Alternative

30 kDa adhesin-related protein (Cytadhesin P30)

Abbreviation

Recombinant Mycoplasma pneumoniae P30 adhesin protein

Gene Name

P30

UniProt

P75330

Expression Region

1-274aa

Organism

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Target Sequence

MKLPPRRKLKLFLLAWMLVLFSALIVLATLILVQHNNTELTEVKSELSPLNVVLHAEEDTVQIQGKPITEQAWFIPTVAGCFGFSALAIILGLAIGLPIVKRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-500 1x 500 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
BNC740523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL
BNC881846-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker) (rGPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL
BNC472883-500 1x 500 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF488A conjugate, 0.1mg/mL
BNC880634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details