BOC, Human (HEK293, His)

BOC Protein, Human (HEK293, His) is a recombinant human BOC produced in HEK293 cells. BOC is a receptor-like protein that, with the related factor CDO, belongs to a newly recognized subfamily within the immunoglobulin superfamily of cell-surface molecules. BOC and CDO form complexes that positively regulate myogenesis in vitro[1].

Product Specifications

Product Name Alternative

BOC Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/boc-protein-human-hek293-his.html

Smiles

ADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSHHHHHH

Molecular Formula

91653 (Gene_ID) Q96DN7 (A30-S157) (Accession)

Molecular Weight

Approximately 20-38 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kang JS, et al. BOC, an Ig superfamily member, associates with CDO to positively regulate myogenic differentiation. EMBO J. 2002;21 (1-2) :114-124.|[2]Mulieri PJ, et al. Expression of the boc gene during murine embryogenesis. Dev Dyn. 2002;223 (3) :379-388.