Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293.html

Purity

97.20

Smiles

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ORAV1 antibody
MBS5301160-01 0.1 mg

ORAV1 antibody

Ask
View Details
ORAV1 antibody
MBS5301160-02 5x 0.1 mg

ORAV1 antibody

Ask
View Details
CD16 (CD16A, CD16a Antigen, Fc gamma R3, Fc gamma RIII alpha, Fc gamma RIII, Fc gamma RIIIa, FCRIIIA, FCGRIII, FCG3, FCGR3A, FCGR3A Protein, FcR10, FcR-10, FcRIII, FcRIIIa, IGFR3, IgG Fc Receptor III-2, Low Affinity Immunoglobulin gamma Fc Region Receptor III-A) discontinued
137638 200 Tests

CD16 (CD16A, CD16a Antigen, Fc gamma R3, Fc gamma RIII alpha, Fc gamma RIII, Fc gamma RIIIa, FCRIIIA, FCGRIII, FCG3, FCGR3A, FCGR3A Protein, FcR10, FcR-10, FcRIII, FcRIIIa, IGFR3, IgG Fc Receptor III-2, Low Affinity Immunoglobulin gamma Fc Region Receptor III-A) discontinued

Ask
View Details
2-Ethyl-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid hydrochloride
sc-307922 500 mg

2-Ethyl-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid hydrochloride

Ask
View Details
Phospho-MKK7 (Ser271/Thr275) (Clone: R4F9) rabbit mAb PE conjugate
12-4189-100 100 Tests

Phospho-MKK7 (Ser271/Thr275) (Clone: R4F9) rabbit mAb PE conjugate

Ask
View Details