Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293.html

Purity

97.20

Smiles

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DCLK3 antibody
70R-32119 100 ug

DCLK3 antibody

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
MBS2051086-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
MBS2051086-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
MBS2051086-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
MBS2051086-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)
MBS2051086-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Heat Shock 70kDa Protein 1 Like Protein (HSPA1L)

Ask
View Details