Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293.html

Purity

97.20

Smiles

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Serpin A12 Antibody (VP63) [Alexa Fluor 532]
NBP2-80041AF532 0.1 mL

Mouse Monoclonal Serpin A12 Antibody (VP63) [Alexa Fluor 532]

Ask
View Details
DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, Dusty Protein Kinase, Dusty PK, RIP-Homologous Kinase, Receptor-interacting Serine/Threonine-Protein Kinase 5, Sugen Kinase 496, SgK496, DSTYK, KIAA0472, RIP5, RIPK5, SGK496)
314018 100 µL

DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, Dusty Protein Kinase, Dusty PK, RIP-Homologous Kinase, Receptor-interacting Serine/Threonine-Protein Kinase 5, Sugen Kinase 496, SgK496, DSTYK, KIAA0472, RIP5, RIPK5, SGK496)

Ask
View Details
Rat monoclonal antibody to Mouse CD86 (Clone GL1)
MBS378328-01 0.5 mg

Rat monoclonal antibody to Mouse CD86 (Clone GL1)

Ask
View Details
Rat monoclonal antibody to Mouse CD86 (Clone GL1)
MBS378328-02 5x 0.5 mg

Rat monoclonal antibody to Mouse CD86 (Clone GL1)

Ask
View Details
Rabbit Polyclonal SLC25A44 Antibody
NBP2-56950 100 µL

Rabbit Polyclonal SLC25A44 Antibody

Ask
View Details
PCDNA3.1-3xHA-PELI1 (human) -Y154F-T175A-T264A
BZ30821 1 Vial

PCDNA3.1-3xHA-PELI1 (human) -Y154F-T175A-T264A

Ask
View Details