Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293.html

Purity

97.20

Smiles

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chicken Polyclonal Chicken anti-Rat IgG (H+L) Secondary Antibody [PE/Atto594]
NBP1-75363PEATT594 0.5 mL

Chicken Polyclonal Chicken anti-Rat IgG (H+L) Secondary Antibody [PE/Atto594]

Ask
View Details
Rabbit Polyclonal MIST1 Antibody [DyLight 488]
NBP2-82007G 0.1 mL

Rabbit Polyclonal MIST1 Antibody [DyLight 488]

Ask
View Details
NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 550)
MBS6325979-01 0.1 mL

NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 550)

Ask
View Details
NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 550)
MBS6325979-02 5x 0.1 mL

NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 550)

Ask
View Details
Probable ribonuclease 11 (RNASE11) Human ELISA Kit
G1372 96 Tests

Probable ribonuclease 11 (RNASE11) Human ELISA Kit

Ask
View Details
Rabbit Fructose-bisphosphate aldolase A,ALDOA ELISA KIT
ELI-04500Ra 96 Tests

Rabbit Fructose-bisphosphate aldolase A,ALDOA ELISA KIT

Ask
View Details