Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293.html

Purity

97.20

Smiles

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZBTB22, CT (ZBTB22, BING1, ZBTB22A, ZNF297, Zinc finger and BTB domain-containing protein 22, Protein BING1, Zinc finger and BTB domain-containing protein 22A, Zinc finger protein 297) (Azide free) (HRP) discontinued
043994-HRP 200 µL

ZBTB22, CT (ZBTB22, BING1, ZBTB22A, ZNF297, Zinc finger and BTB domain-containing protein 22, Protein BING1, Zinc finger and BTB domain-containing protein 22A, Zinc finger protein 297) (Azide free) (HRP) discontinued

Ask
View Details
FDXR Polyclonal Antibody
ANT-12163-50ug 50 µg

FDXR Polyclonal Antibody

Ask
View Details
Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody
MBS1752534-01 0.01 mg

Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody

Ask
View Details
Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody
MBS1752534-02 0.1 mg (Carrier Free)

Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody

Ask
View Details
Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody
MBS1752534-03 0.1 mg

Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody

Ask
View Details
Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody
MBS1752534-04 0.1 mg (Cy3)

Anti-Troponin I Fast Skeletal Muscle/TNNI2 Antibody

Ask
View Details