Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293.html

Purity

97.20

Smiles

ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (A30-P204) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKCBP2, RACK17) (PE)
130711-PE 100 µL

OLIG2 (Oligodendrocyte Transcription Factor 2, Oligo2, Class B Basic Helix-loop-helix Protein 1, bHLHb1, Class E Basic Helix-loop-helix Protein 19, bHLHe19, Protein Kinase C-binding Protein 2, Protein Kinase C-binding Protein RACK17, BHLHB1, BHLHE19, PRKCBP2, RACK17) (PE)

Ask
View Details
Palladin Rabbit Monoclonal Antibody
E49Y7445 100 µL

Palladin Rabbit Monoclonal Antibody

Ask
View Details
Gelatin Peptone
RM020-5KG 5 Kg

Gelatin Peptone

Ask
View Details
Recombinant Mycoplasma genitalium 10 kDa chaperonin (groS)
MBS1254345-01 0.02 mg (E-Coli)

Recombinant Mycoplasma genitalium 10 kDa chaperonin (groS)

Ask
View Details
Recombinant Mycoplasma genitalium 10 kDa chaperonin (groS)
MBS1254345-02 0.1 mg (E-Coli)

Recombinant Mycoplasma genitalium 10 kDa chaperonin (groS)

Ask
View Details
Recombinant Mycoplasma genitalium 10 kDa chaperonin (groS)
MBS1254345-03 0.02 mg (Yeast)

Recombinant Mycoplasma genitalium 10 kDa chaperonin (groS)

Ask
View Details