Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human REST corepressor 1 (RCOR1), partial, Biotinylated

Product Specifications

Product Name Alternative

Protein CoREST

Abbreviation

Recombinant Human RCOR1 protein, partial, Biotinylated

Gene Name

RCOR1

UniProt

Q9UKL0

Expression Region

4-485aa

Organism

Homo sapiens (Human)

Target Sequence

MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

100.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO7B Human Gene Knockout Kit (CRISPR)
KN424362 1 Kit

MYO7B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-2 (124), CF488A conjugate, 0.1mg/mL
BNC880530-500 1x 500 µL

Bcl-2 (124), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GARS Mouse Monoclonal Antibody [Clone ID: AT4E10]
AM50342PU-S 50 µL

GARS Mouse Monoclonal Antibody [Clone ID: AT4E10]

Sign In for Pricing
View Details
o-Cresol Beta-D-Glucuronide
TRC-C782000-5MG 5 mg

o-Cresol Beta-D-Glucuronide

Sign In for Pricing
View Details
Recombinant Human GPR37 Protein (His Tag)
PKSH030621 100 µg

Recombinant Human GPR37 Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), Biotin conjugate, 0.1mg/mL
BNCB0371-100 1x 100 µL

Cytokeratin, pan (AE-1 / AE-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details