Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 18 protein (TNFSF18), partial (Active)

Product Specifications

Product Name Alternative

Activation-inducible TNF-related ligand, Glucocorticoid-induced TNF-related ligand, hGITRL

Abbreviation

Recombinant Human TNFSF18 protein, partial (Active)

Gene Name

TNFSF18

UniProt

Q9UNG2

Expression Region

74-199aa

Organism

Homo sapiens (Human)

Target Sequence

ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Cancer

Relevance

Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1 (PubMed:23892569) . Promotes leukocyte adhesion to endothelial cells (PubMed:23892569) . Regulates migration of monocytes from the splenic reservoir to sites of inflammation (By similarity) . {ECO:0000250|UniProtKB:Q7TS55, ECO:0000269|PubMed:17449724, ECO:0000269|PubMed:18040044, ECO:0000269|PubMed:23892569}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity as determined by stimulation of IL-8 production using human PBMC is in a concentration range of 0.1-10 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PRP19 Antibody FITC-Conjugated
MBS544332-01 0.1 mg

Phospho-PRP19 Antibody FITC-Conjugated

Sign In for Pricing
View Details
Phospho-PRP19 Antibody FITC-Conjugated
MBS544332-02 5x 0.1 mg

Phospho-PRP19 Antibody FITC-Conjugated

Sign In for Pricing
View Details
TWIST1 (Twist-related Protein 1)
494926 100 µL

TWIST1 (Twist-related Protein 1)

Sign In for Pricing
View Details
Human PCDHB3 Pre-designed siRNA Set B
SI011783B 1 Each

Human PCDHB3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SPRED2 (Sprouty-Related, EVH1 Domain Containing 2, FLJ21897, FLJ31917, MGC163164, Spred-2) (MaxLight 405)
MBS6198059-01 0.1 mL

SPRED2 (Sprouty-Related, EVH1 Domain Containing 2, FLJ21897, FLJ31917, MGC163164, Spred-2) (MaxLight 405)

Sign In for Pricing
View Details
SPRED2 (Sprouty-Related, EVH1 Domain Containing 2, FLJ21897, FLJ31917, MGC163164, Spred-2) (MaxLight 405)
MBS6198059-02 5x 0.1 mL

SPRED2 (Sprouty-Related, EVH1 Domain Containing 2, FLJ21897, FLJ31917, MGC163164, Spred-2) (MaxLight 405)

Sign In for Pricing
View Details