Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein L-Myc (MYCL), partial

Product Specifications

Product Name Alternative

Class E basic helix-loop-helix protein 38; bHLHe38; Protein L-Myc-1; V-myc myelocytomatosis viral oncogene homolog

Abbreviation

Recombinant Human MYCL protein, partial

Gene Name

MYCL

UniProt

P12524

Expression Region

242-364aa

Organism

Homo sapiens (Human)

Target Sequence

AAGEKEDEEDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K4 (Mitogen-Activated Protein Kinase Kinase Kinase 4, FLJ42439, KIAA0213, MAPKKK4, MEKK4, MTK1, PRO0412) (MaxLight 490)
248454-ML490 100 µL

MAP3K4 (Mitogen-Activated Protein Kinase Kinase Kinase 4, FLJ42439, KIAA0213, MAPKKK4, MEKK4, MTK1, PRO0412) (MaxLight 490)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2117509-01 0.1 mL

APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2117509-02 0.2 mL

APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2117509-03 0.5 mL

APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2117509-04 1 mL

APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details
APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)
MBS2117509-05 5 mL

APC-Cy7 Linked Monoclonal Antibody to T-Cell Surface Glycoprotein CD3 Epsilon (CD3e)

Sign In for Pricing
View Details