Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADIPOR1, Human (Cell-Free)

ADIPOR1 Protein, a receptor for adiponectin (ADIPOQ), crucially regulates glucose and lipid metabolism, maintaining homeostasis and healthy body weight. Upon ADIPOQ binding, ADIPOR1 activates AMPK, promoting fatty acid oxidation and glucose uptake while inhibiting gluconeogenesis. ADIPOR1 interacts with APPL2, negatively regulating signaling, and with APPL1, enhancing ADIPOQ-induced recruitment and positive regulation of adiponectin signaling. ADIPOR1 Protein, Human (Cell-Free) is the recombinant human-derived ADIPOR1 protein, expressed by E. coli Cell-free , with tag free.

Product Specifications

Product Name Alternative

ADIPOR1 Protein, Human (Cell-Free), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adipor1-protein-human-cf.html

Purity

90.00

Smiles

EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Molecular Formula

51094 (Gene_ID) Q96A54 (E89-L375) (Accession)

Molecular Weight

30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMPF
TRC-C595000-5MG 5 mg

CMPF

Sign In for Pricing
View Details
CYP2R1 Rabbit Polyclonal Antibody
AP14747PU-N 400 µL

CYP2R1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-542-01 50 μL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-542-02 100 µL

GAP43 Antibody

Sign In for Pricing
View Details
GAP43 Antibody
KC-542-03 1 mL

GAP43 Antibody

Sign In for Pricing
View Details
GRAMD2A (NM_001012642) Human Over-expression Lysate
LC422890 20 µg

GRAMD2A (NM_001012642) Human Over-expression Lysate

Sign In for Pricing
View Details