Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-2, Mouse

BD-2 Protein, Mouse is an anti-microbial peptide that participates in the response to microbial invasion.

Product Specifications

Product Name Alternative

BD-2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-2-protein-mouse.html

Purity

98.0

Smiles

AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK

Molecular Formula

13215 (Gene_ID) P82020 (A21-K71) (Accession)

Molecular Weight

Approximately 5.5 kDa

References & Citations

[1]Kwon JK, et al. Murine β-defensin-2 may regulate the effect of bacillus Calmette-Guérin (BCG) in normal mouse bladder. Urol Oncol. 2015 Mar;33 (3) :111.e9-16.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Reelin (RL) ELISA Kit
MBS4502244-01 48 Tests

Mouse Reelin (RL) ELISA Kit

Sign In for Pricing
View Details
Mouse Reelin (RL) ELISA Kit
MBS4502244-02 96 Tests

Mouse Reelin (RL) ELISA Kit

Sign In for Pricing
View Details
Mouse Reelin (RL) ELISA Kit
MBS4502244-03 5x 96 Tests

Mouse Reelin (RL) ELISA Kit

Sign In for Pricing
View Details
Mouse Reelin (RL) ELISA Kit
MBS4502244-04 10x 96 Tests

Mouse Reelin (RL) ELISA Kit

Sign In for Pricing
View Details
PSMD2 Human Over-expression Lysate
orb1345192 100 µg

PSMD2 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Fastkd3 Pre-designed siRNA Set A
SI104742A 1 Each

Mouse Fastkd3 Pre-designed siRNA Set A

Sign In for Pricing
View Details