Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-2, Mouse

BD-2 Protein, Mouse is an anti-microbial peptide that participates in the response to microbial invasion.

Product Specifications

Product Name Alternative

BD-2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-2-protein-mouse.html

Purity

98.0

Smiles

AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK

Molecular Formula

13215 (Gene_ID) P82020 (A21-K71) (Accession)

Molecular Weight

Approximately 5.5 kDa

References & Citations

[1]Kwon JK, et al. Murine β-defensin-2 may regulate the effect of bacillus Calmette-Guérin (BCG) in normal mouse bladder. Urol Oncol. 2015 Mar;33 (3) :111.e9-16.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIAS Antibody
30-437 100 µL

LIAS Antibody

Sign In for Pricing
View Details
VEGFR2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-10412R-BF594-TR 20 µL

VEGFR2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
MBS2166930-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
MBS2166930-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
MBS2166930-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)
MBS2166930-04 1 mL

Biotin-Linked Monoclonal Antibody to Tissue Factor Pathway Inhibitor (TFPI)

Sign In for Pricing
View Details