Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin, Human (HEK293, Fc)

Galanin exists as an endocrine hormone in the central and peripheral nervous systems and exerts its effects by binding to and activating G protein-coupled receptors (i.e., GALR1, GALR2, and GALR3) . Galanin Protein, Human (HEK293, Fc) is the recombinant human-derived Galanin protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Galanin Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galanin-protein-human-hek293-fc.html

Purity

98.0

Smiles

ASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

Molecular Formula

51083 (Gene_ID) P22466 (A20-S123) (Accession)

Molecular Weight

Approximately 43 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBA52 (NM_001033930) Human Over-expression Lysate
LC422429 20 µg

UBA52 (NM_001033930) Human Over-expression Lysate

Sign In for Pricing
View Details
CD4 (Ab-433) Antibody
8B0846-AAT 50 µg

CD4 (Ab-433) Antibody

Sign In for Pricing
View Details
1-(4-(4-Hydroxyphenyl)butan-2-yl)-1H-indole-5,6-diol
TRC-H825650-50MG 50 mg

1-(4-(4-Hydroxyphenyl)butan-2-yl)-1H-indole-5,6-diol

Sign In for Pricing
View Details
BAG3 Antibody
KC-18384-01 50 μL

BAG3 Antibody

Sign In for Pricing
View Details
BAG3 Antibody
KC-18384-02 100 µL

BAG3 Antibody

Sign In for Pricing
View Details
BAG3 Antibody
KC-18384-03 1 mL

BAG3 Antibody

Sign In for Pricing
View Details