FGL1, Human (HEK293, His, solution)
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, His, solution) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
FGL1 Protein, Human (HEK293, His, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek-293-his.html
Purity
98.0
Smiles
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular Formula
2267 (Gene_ID) Q08830 (L23-I312) (Accession)
Molecular Weight
Approximately 35.0 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470991-100 1x 100 µL
SOX10 (SOX10/991), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details