FGL1, Human (HEK293, His, solution)
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, His, solution) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
FGL1 Protein, Human (HEK293, His, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek-293-his.html
Purity
98.0
Smiles
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Molecular Formula
2267 (Gene_ID) Q08830 (L23-I312) (Accession)
Molecular Weight
Approximately 35.0 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035134-Biotin 200 µL
EPS8L2, NT (EPS8L2, EPS8R2, Epidermal growth factor receptor kinase substrate 8-like protein 2, Epidermal growth factor receptor pathway substrate 8-related protein 2) (Biotin) discontinued
Sign In for Pricing
View Details 
K6590907 1.0 µg DNA
Dnajb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details