Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4E, Human (HEK293, His)

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the immune system.It detects and binds DAMPs and PAMPs, including α-mannose residues on mycobacterial TDM and fungi.CLEC4E Protein, Human (HEK293, His) is the recombinant human-derived CLEC4E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CLEC4E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4e-protein-human-hek-293-his.html

Purity

97.00

Smiles

RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

Molecular Formula

26253 (Gene_ID) Q9ULY5 (R41-L219) (Accession)

Molecular Weight

Approximately 26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal S100P Antibody (S100P/4386R) [DyLight 680]
NBP3-08769FR 100 µL

Rabbit Monoclonal S100P Antibody (S100P/4386R) [DyLight 680]

Sign In for Pricing
View Details
AI848285 siRNA Oligos set (Mouse)
11591174 3x 5 nmol

AI848285 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
LOC499796 3'UTR GFP Stable Cell Line
TU260182 1.0 mL

LOC499796 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human EGR4 (Early Growth Response Protein 4) ELISA Kit
MBS2512327-01 24 Tests (Limit 1)

Human EGR4 (Early Growth Response Protein 4) ELISA Kit

Sign In for Pricing
View Details
Human EGR4 (Early Growth Response Protein 4) ELISA Kit
MBS2512327-02 48 Tests

Human EGR4 (Early Growth Response Protein 4) ELISA Kit

Sign In for Pricing
View Details
Human EGR4 (Early Growth Response Protein 4) ELISA Kit
MBS2512327-03 96 Tests

Human EGR4 (Early Growth Response Protein 4) ELISA Kit

Sign In for Pricing
View Details