Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serum amyloid A-4 protein (Saa4)

Product Specifications

Product Name Alternative

(Amyloid A-5 protein)

Abbreviation

Recombinant Mouse Saa4 protein

Gene Name

Saa4

UniProt

P31532

Expression Region

19-130aa

Organism

Mus musculus (Mouse)

Target Sequence

DGWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

"Structure of the mouse serum amyloid A 5 (Saa5) gene: relationship to other members of the serum amyloid A family." Butler A., Whitehead A.S. Scand. J. Immunol. 45:160-165 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human P2RX2 full length protein-synthetic nanodisc
MBS1883163-01 0.01 mg

Human P2RX2 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human P2RX2 full length protein-synthetic nanodisc
MBS1883163-02 0.05 mg

Human P2RX2 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human P2RX2 full length protein-synthetic nanodisc
MBS1883163-03 0.1 mg

Human P2RX2 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Gm3750 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3138406 1.0 µg DNA

Gm3750 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-C-Raf (C-terminus) Antibody
RP2071 100 µL

Anti-C-Raf (C-terminus) Antibody

Sign In for Pricing
View Details
Gm7030 ORF Vector (Mouse) (pORF)
ORF046190 1.0 µg DNA

Gm7030 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details