Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serum amyloid A-4 protein (Saa4)

Product Specifications

Product Name Alternative

(Amyloid A-5 protein)

Abbreviation

Recombinant Mouse Saa4 protein

Gene Name

Saa4

UniProt

P31532

Expression Region

19-130aa

Organism

Mus musculus (Mouse)

Target Sequence

DGWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Major acute phase reactant.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

"Structure of the mouse serum amyloid A 5 (Saa5) gene: relationship to other members of the serum amyloid A family." Butler A., Whitehead A.S. Scand. J. Immunol. 45:160-165 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTN (Pleiotrophin) Rabbit ELISA Kit
G5075 96 Tests

PTN (Pleiotrophin) Rabbit ELISA Kit

Sign In for Pricing
View Details
Inhibin beta B (INHBB) (NM_002193) Human 3' UTR Clone
SC217160 10 µg

Inhibin beta B (INHBB) (NM_002193) Human 3' UTR Clone

Sign In for Pricing
View Details
L-Carnitine Colorimetric Microplate Assay Kit
CAK1244 100 Assays

L-Carnitine Colorimetric Microplate Assay Kit

Sign In for Pricing
View Details
RNF8 (RNF8, KIAA0646, E3 ubiquitin-protein ligase RNF8, RING finger protein 8) (APC)
MBS6342974-01 0.2 mL

RNF8 (RNF8, KIAA0646, E3 ubiquitin-protein ligase RNF8, RING finger protein 8) (APC)

Sign In for Pricing
View Details
RNF8 (RNF8, KIAA0646, E3 ubiquitin-protein ligase RNF8, RING finger protein 8) (APC)
MBS6342974-02 5x 0.2 mL

RNF8 (RNF8, KIAA0646, E3 ubiquitin-protein ligase RNF8, RING finger protein 8) (APC)

Sign In for Pricing
View Details
BPTF 3'UTR GFP Stable Cell Line
TU051870 1.0 mL

BPTF 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details