Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Rat

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FXN Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-rat.html

Smiles

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Molecular Formula

499335 (Gene_ID) D3ZYW7 (L41-T208) (Accession)

Molecular Weight

Approximately 18.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)
MBS7028783-01 0.02 mg

Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)
MBS7028783-02 0.1 mg

Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)
MBS7028783-03 5x 0.1 mg

Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217 (rnf217)

Sign In for Pricing
View Details
2-Methyloctahydro-1H-pyrazino[1,2-a]pyrazine trihydrochloride
JH917974 1 Each

2-Methyloctahydro-1H-pyrazino[1,2-a]pyrazine trihydrochloride

Sign In for Pricing
View Details
18:1 (n9) -16:0 PG-IsoPure sodium
orb3138059-01 10 mg

18:1 (n9) -16:0 PG-IsoPure sodium

Sign In for Pricing
View Details
18:1 (n9) -16:0 PG-IsoPure sodium
orb3138059-02 50 mg

18:1 (n9) -16:0 PG-IsoPure sodium

Sign In for Pricing
View Details