Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Rat

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FXN Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-rat.html

Smiles

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Molecular Formula

499335 (Gene_ID) D3ZYW7 (L41-T208) (Accession)

Molecular Weight

Approximately 18.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-4-iodo-1-(triisopropylsilyl)-1H-pyrrole
TRC-B899080-250MG 250 mg

3-Bromo-4-iodo-1-(triisopropylsilyl)-1H-pyrrole

Sign In for Pricing
View Details
(3aR,4R,5R,6aS)-Hexahydro-5-hydroxy-4-(3-oxo-1-decenyl)-2H-cyclopenta[b]furan-2-one 5-(4-Phenylbenzoate)-d15
TRC-H294037-25MG 25 mg

(3aR,4R,5R,6aS)-Hexahydro-5-hydroxy-4-(3-oxo-1-decenyl)-2H-cyclopenta[b]furan-2-one 5-(4-Phenylbenzoate)-d15

Sign In for Pricing
View Details
Phytic Acid Potassium Salt
TRC-P398710-1G 1 g

Phytic Acid Potassium Salt

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF647 conjugate, 0.1mg/mL
BNC473126-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL
BNC402747-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mono-tert-butyl Malonate
TRC-M525030-50G 50 g

Mono-tert-butyl Malonate

Sign In for Pricing
View Details