Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Rat

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FXN Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-rat.html

Smiles

LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

Molecular Formula

499335 (Gene_ID) D3ZYW7 (L41-T208) (Accession)

Molecular Weight

Approximately 18.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR3659 Human qPCR Primer Pair (MI0016060)
HP300840 200 Reactions

MIR3659 Human qPCR Primer Pair (MI0016060)

Sign In for Pricing
View Details
LAMP1 Recombinant Rabbit Monoclonal Antibody [JJ0940]
ET1701-94 100 µL

LAMP1 Recombinant Rabbit Monoclonal Antibody [JJ0940]

Sign In for Pricing
View Details
2'-Deoxy-6-thio Guanosine
TRC-D281650-10MG 10 mg

2'-Deoxy-6-thio Guanosine

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), Biotin conjugate, 0.1mg/mL
BNCB2313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1b (RIV12), Biotin conjugate, 0.1mg/mL
BNCB0317-100 1x 100 µL

CD1b (RIV12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C14orf93 Human Gene Knockout Kit (CRISPR)
KN421403 1 Kit

C14orf93 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details