Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANK1 mouse monoclonal antibody, clone N388A/60
73-381 5 mL

ANK1 mouse monoclonal antibody, clone N388A/60

Sign In for Pricing
View Details
WBP1L siRNA (Human)
CRJ0254-01 15 nmol

WBP1L siRNA (Human)

Sign In for Pricing
View Details
WBP1L siRNA (Human)
CRJ0254-02 30 nmol

WBP1L siRNA (Human)

Sign In for Pricing
View Details
GATA2 (GATA Binding Protein 2, GATA-Binding Protein 2) (MaxLight 490)
MBS6204809-01 0.1 mL

GATA2 (GATA Binding Protein 2, GATA-Binding Protein 2) (MaxLight 490)

Sign In for Pricing
View Details
GATA2 (GATA Binding Protein 2, GATA-Binding Protein 2) (MaxLight 490)
MBS6204809-02 5x 0.1 mL

GATA2 (GATA Binding Protein 2, GATA-Binding Protein 2) (MaxLight 490)

Sign In for Pricing
View Details
NRG2 protein, Human, Recombinant (His)
E51P91362 20 µg

NRG2 protein, Human, Recombinant (His)

Sign In for Pricing
View Details