Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYRK1B Protein Vector (Mouse) (pPM-C-HA)
PV173964 500 ng

DYRK1B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
H2 (H2-D1) (NM_010380) Mouse Tagged Lenti ORF Clone
MR225660L4 10 µg

H2 (H2-D1) (NM_010380) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal c-Myc Antibody (Myc.A7) [DyLight 350]
NBP2-37822UV 0.1 mL

Mouse Monoclonal c-Myc Antibody (Myc.A7) [DyLight 350]

Sign In for Pricing
View Details
ASXL2 Human Gene Knockout Kit (CRISPR)
KN420364 1 Kit

ASXL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ELAVL2 Antibody (Center) Blocking peptide
MBS9219522-01 0.5 mg

ELAVL2 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
ELAVL2 Antibody (Center) Blocking peptide
MBS9219522-02 5x 0.5 mg

ELAVL2 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details