Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neopterin) Chicken ELISA Kit
F3016 96 Tests

Neopterin) Chicken ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Cd226 shRNA (UAS) - Lentiviral mouse Cd226 shRNA (UAS) plasmid
GTR15265951 1 Vial

Lentiviral mouse Cd226 shRNA (UAS) - Lentiviral mouse Cd226 shRNA (UAS) plasmid

Sign In for Pricing
View Details
TDP2 (Tyrosyl-DNA Phosphodiesterase 2, Tyr-DNA Phosphodiesterase 2, hTDP2, 5'-tyrosyl-DNA Phosphodiesterase, 5'-Tyr-DNA Phosphodiesterase, AD022, AD-022, ETS1-associated Protein 2, EAP2, ETS1-associated Protein II, EAPII, TRAF and TNF Receptor-associated Protein, TTRAP, Tyrosyl-RNA Phosphodiesterase, VPg Unlinkase) (MaxLight 750) discontinued
134873-ML750 100 µL

TDP2 (Tyrosyl-DNA Phosphodiesterase 2, Tyr-DNA Phosphodiesterase 2, hTDP2, 5'-tyrosyl-DNA Phosphodiesterase, 5'-Tyr-DNA Phosphodiesterase, AD022, AD-022, ETS1-associated Protein 2, EAP2, ETS1-associated Protein II, EAPII, TRAF and TNF Receptor-associated Protein, TTRAP, Tyrosyl-RNA Phosphodiesterase, VPg Unlinkase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Leptin Receptor (LEPR) (NM_001198688) Human Tagged Lenti ORF Clone
RC231439L4 10 µg

Leptin Receptor (LEPR) (NM_001198688) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal PTP1B/PTPN1 Antibody (226) [DyLight 550]
NBP2-89400R 0.1 mL

Rabbit Monoclonal PTP1B/PTPN1 Antibody (226) [DyLight 550]

Sign In for Pricing
View Details
Phospho-PIK3R2 (Tyr467) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5582R-PE-Cy5 100 µL

Phospho-PIK3R2 (Tyr467) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details