Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC690517 3'UTR Luciferase Stable Cell Line
TU212145 1.0 mL

LOC690517 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
hsa-miR-3120 miRNA Inhibitor
MIH01713 2x 5.0 nmol

hsa-miR-3120 miRNA Inhibitor

Sign In for Pricing
View Details
RNA polymerase II Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6972R-BF680-01 20 µL

RNA polymerase II Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
RNA polymerase II Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6972R-BF680-02 100 µL

RNA polymerase II Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
C2orf50 (NM_182500) Human Over-expression Lysate
LS130813-100ug 100 µg

C2orf50 (NM_182500) Human Over-expression Lysate

Sign In for Pricing
View Details
Vigilin Double Nickase Plasmid (h)
sc-404125-NIC 20 µg

Vigilin Double Nickase Plasmid (h)

Sign In for Pricing
View Details