Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurturin (NRTN) Rabbit Polyclonal Antibody
TA322724 100 µL

Neurturin (NRTN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rab11fip5 ORF Vector (Mouse) (pORF)
ORF055397 1.0 µg DNA

Rab11fip5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Bis-Tris Hydrochloride Buffer
40121239-2 1 L

Bis-Tris Hydrochloride Buffer

Sign In for Pricing
View Details
FLJ32679 ORF Vector (Human) (pORF)
20638011 1.0 µg DNA

FLJ32679 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
2- (3-Iodophenyl) acetic acid
280931-01 1 g

2- (3-Iodophenyl) acetic acid

Sign In for Pricing
View Details
2- (3-Iodophenyl) acetic acid
280931-02 2 g

2- (3-Iodophenyl) acetic acid

Sign In for Pricing
View Details