Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC25A39 shRNA (UAS) - Lentiviral human SLC25A39 shRNA (UAS, RFP) (25)
GTR15116231 1 Vial

Lentiviral human SLC25A39 shRNA (UAS) - Lentiviral human SLC25A39 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Usp16 (NM_024258) Mouse Tagged ORF Clone Lentiviral Particle
MR210833L3V 200 µL

Usp16 (NM_024258) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)
MBS1361026-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)
MBS1361026-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)
MBS1361026-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)
MBS1361026-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Molybdopterin synthase catalytic subunit (mocs2l)

Sign In for Pricing
View Details