Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GXYLT1 Human siRNA Oligo Duplex (Locus ID 283464)
SR326115 1 Kit

GXYLT1 Human siRNA Oligo Duplex (Locus ID 283464)

Sign In for Pricing
View Details
Mouse Monoclonal CXCL11/I-TAC Antibody (B-S40) [Alexa Fluor 594]
NBP3-18117AF594 0.1 mL

Mouse Monoclonal CXCL11/I-TAC Antibody (B-S40) [Alexa Fluor 594]

Sign In for Pricing
View Details
ADFN sgRNA CRISPR Lentivector set (Human)
K0048901 3x 1.0 µg

ADFN sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
5-Bromo-4-chloro-3-indolyl-α-D-mannopyranoside, 93%
HY-15934A-01 5 mg

5-Bromo-4-chloro-3-indolyl-α-D-mannopyranoside, 93%

Sign In for Pricing
View Details
5-Bromo-4-chloro-3-indolyl-α-D-mannopyranoside, 93%
HY-15934A-02 10 mg

5-Bromo-4-chloro-3-indolyl-α-D-mannopyranoside, 93%

Sign In for Pricing
View Details
5-Bromo-4-chloro-3-indolyl-α-D-mannopyranoside, 93%
HY-15934A-03 25 mg

5-Bromo-4-chloro-3-indolyl-α-D-mannopyranoside, 93%

Sign In for Pricing
View Details