Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cxcr4 (NM_009911) Mouse Tagged Lenti ORF Clone
MR205485L2 10 µg

Cxcr4 (NM_009911) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Porcine Peroxisome Proliferator Activated Receptor Gamma (PPAR-γ) ELISA Kit
NSL1218Po 96 Tests

Porcine Peroxisome Proliferator Activated Receptor Gamma (PPAR-γ) ELISA Kit

Sign In for Pricing
View Details
Human PEX13 (NM_002618) AAV Particle
RC209140A1V 250 µL

Human PEX13 (NM_002618) AAV Particle

Sign In for Pricing
View Details
Lentiviral mouse Gm5168 shRNA (UAS) - Lentiviral mouse Gm5168 shRNA (UAS) (25)
GTR15191549 1 Vial

Lentiviral mouse Gm5168 shRNA (UAS) - Lentiviral mouse Gm5168 shRNA (UAS) (25)

Sign In for Pricing
View Details
EMSY Human Gene Knockout Kit (CRISPR)
KN216916 1 Kit

EMSY Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Argyrin D
MF-0126020-01 10 mg

Argyrin D

Sign In for Pricing
View Details