Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Mouse (HEK293, C-His)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived LILRB3/CD85a, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-mouse-hek293-c-his.html

Purity

98.0

Smiles

SLPKPILRVQPDSVVSRWTKVTFFCEETIGANEYRLYKDGKLYKTVTKNKQKPANKAEFSLSNVDLRNAGQYRCSYSTQYKSSGYSDPLELVVTGDYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKRAMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGKFFIPSMTRQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKFGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGLSKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQNSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMY

Molecular Formula

18733 (Gene_ID) AAC53219 (S25-Y640) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Hydrophila tgt Protein
VAng-Lsx0988-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Hydrophila tgt Protein

Sign In for Pricing
View Details
Histone H2A.X (Phospho-Ser139) Antibody
MBS9503050-01 0.05 mL

Histone H2A.X (Phospho-Ser139) Antibody

Sign In for Pricing
View Details
Histone H2A.X (Phospho-Ser139) Antibody
MBS9503050-02 0.1 mL

Histone H2A.X (Phospho-Ser139) Antibody

Sign In for Pricing
View Details
Histone H2A.X (Phospho-Ser139) Antibody
MBS9503050-03 5x 0.1 mL

Histone H2A.X (Phospho-Ser139) Antibody

Sign In for Pricing
View Details
Dazl 3'UTR Luciferase Stable Cell Line
TU104857 1.0 mL

Dazl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Cyclin D1 Antibody (DCS-6) [Janelia Fluor 549]
NBP2-33138JF549 0.1 mL

Mouse Monoclonal Cyclin D1 Antibody (DCS-6) [Janelia Fluor 549]

Sign In for Pricing
View Details