Animal-Free IL-15, Pig (His)
The IL-15 protein is a key cytokine that promotes inflammatory and protective immune responses against invaders by regulating immune cells in the innate and adaptive systems. It stimulates natural killer cells, T cells and B cells, and promotes the secretion of various cytokines. Animal-Free IL-15 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-15 Protein, Pig (His), Pig, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-15-protein-pig-his.html
Purity
95.00
Smiles
TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINEFLKSFIHIVQMFINPS
Molecular Formula
397683 (Gene_ID) Q95253 (T49-S162) (Accession)
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Inactive ubiquitin carboxyl-terminal hydrolase 53 (USP53) Antibody
Inactive ubiquitin carboxyl-terminal hydrolase 53 (USP53) Antibody
Lentiviral mouse Dppa5a shRNA (UAS) - Lentiviral mouse Dppa5a shRNA (UAS, iRFP) plasmid
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 9 (MMP9)