Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FIS1, Human (His)

The FIS1 protein is essential for mitochondrial network fragmentation and perinuclear clustering. Although FIS1 plays a minor role in recruiting DNM1L to the mitochondrial surface, it is associated with fission. FIS1 Protein, Human (His) is the recombinant human-derived FIS1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FIS1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fis1-protein-human-his.html

Purity

98.0

Smiles

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Molecular Formula

51024 (Gene_ID) Q9Y3D6 (M1-G122) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID2 Human qPCR Template Standard (NM_002166)
HK203897 1 Kit

ID2 Human qPCR Template Standard (NM_002166)

Sign In for Pricing
View Details
Mouse ELANE shRNA Plasmid
abx974090-01 150 µg

Mouse ELANE shRNA Plasmid

Sign In for Pricing
View Details
Mouse ELANE shRNA Plasmid
abx974090-02 300 µg

Mouse ELANE shRNA Plasmid

Sign In for Pricing
View Details
ELISA Kit for A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)
TRV-0063001-01 24 Tests

ELISA Kit for A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)

Sign In for Pricing
View Details
ELISA Kit for A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)
TRV-0063001-02 48 Tests

ELISA Kit for A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)

Sign In for Pricing
View Details
ELISA Kit for A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)
TRV-0063001-03 96 Tests

ELISA Kit for A Disintegrin And Metalloproteinase With Thrombospondin 4 (ADAMTS4)

Sign In for Pricing
View Details