CD79B, Rhesus Macaque (HEK293, His)
CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html
Purity
95.93
Smiles
AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD
Molecular Formula
718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)
Molecular Weight
20-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Schizosaccharomyces Pombe SPCC1281.06c Protein (aa 1-479)
Myosin Light Chain 2 (MYL2) Human shRNA Plasmid Kit (Locus ID 4633)
![c-Jun (JUN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]](https://cdn.genprice.uk/products/937/6868c39f994c49e6dc3fabfa/imageurl/ta800612bm.webp)
c-Jun (JUN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A4]
Paxillin (PXN) (NM_025157) Human Recombinant Protein
![Rabbit Polyclonal SARS-CoV-2 ORF6 Antibody [Alexa Fluor 488]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
Rabbit Polyclonal SARS-CoV-2 ORF6 Antibody [Alexa Fluor 488]