Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc44a2 Mouse qPCR Template Standard (NM_152808)
MK203384 1 Kit

Slc44a2 Mouse qPCR Template Standard (NM_152808)

Sign In for Pricing
View Details
Mouse Monoclonal CEACAM5/CD66e Antibody (C66/1009) [DyLight 650]
NBP2-47976C 0.1 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (C66/1009) [DyLight 650]

Sign In for Pricing
View Details
NR3C1 Protein Vector (Rat) (pPB-C-His)
PV285966 500 ng

NR3C1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
AKR1B1 Rabbit Polyclonal Antibody
AP12364PU-N 400 µL

AKR1B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (S. cerevisiae), YER112W) (MaxLight 550)
248339-ML550 100 µL

LSM4 (LSM4 Homolog, U6 Small Nuclear RNA Associated (S. cerevisiae), YER112W) (MaxLight 550)

Sign In for Pricing
View Details
MAPK13 Blocking Peptide
MBS543963-01 0.25 mg

MAPK13 Blocking Peptide

Sign In for Pricing
View Details