Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS23P5 3'UTR GFP Stable Cell Line
TU072129 1.0 mL

RPS23P5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MKS1 (NM_017777) Human Over-expression Lysate
LS054903-20ug 20 µg

MKS1 (NM_017777) Human Over-expression Lysate

Sign In for Pricing
View Details
MCM6 (Minichromosome Maintenance Complex Component 6, MCG40308, Mis5, P105MCM) (HRP)
248595-HRP 100 µL

MCM6 (Minichromosome Maintenance Complex Component 6, MCG40308, Mis5, P105MCM) (HRP)

Sign In for Pricing
View Details
TATA Element Modulatory Factor 1 (TMF1) Human Knockdown Lysate
LY300447 100 µg

TATA Element Modulatory Factor 1 (TMF1) Human Knockdown Lysate

Sign In for Pricing
View Details
Human MUC1 (Mucin 1) ELISA Kit
MBS8800203-01 48 Well

Human MUC1 (Mucin 1) ELISA Kit

Sign In for Pricing
View Details
Human MUC1 (Mucin 1) ELISA Kit
MBS8800203-02 96 Well

Human MUC1 (Mucin 1) ELISA Kit

Sign In for Pricing
View Details