Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sendai virus Fusion glycoprotein F0 (F), partial

Product Specifications

Product Name Alternative

(Protein F)

Abbreviation

Recombinant Sendai virus Fusion glycoprotein F0, partial

Gene Name

F

UniProt

P04855

Expression Region

26-116aa

Organism

Sendai virus (strain Z) (SeV) (Sendai virus (strain HVJ) )

Target Sequence

QIPRDRLSNIGVIVDEGKSLKIAGSHESRYIVLSLVPGVDFENGCGTAQVIQYKSLLNRLLIPLRDALDLQEALITVTNDTTQNAGAPQSR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the heptad repeat (HR) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and plasma cell membranes. Directs fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. This fusion is pH independent and occurs directly at the outer cell membrane. The trimer of F1-F2 (F protein) interacts with HN tetramer at the virion surface. Upon HN binding to its cellular receptor, the hydrophobic fusion peptide is unmasked and interacts with the cellular membrane, inducing the fusion between cell and virion membranes. Later in infection, F proteins expressed at the plasma membrane of infected cells could mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

References & Citations

"Functional analysis of the individual oligosaccharide chains of sendai virus fusion protein." Segawa H., Yamashita T., Kawakita M., Taira H. J. Biochem. 128:65-72 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine IgG (Fc specific) Rabbit Polyclonal Antibody
R1311HRP 1.5 mg

Canine IgG (Fc specific) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STRA6 (Stimulated by Retinoic acid Gene 6 Homolog (mouse), FLJ12541, MCOPS9, PP14296, Stimulated by Retinoic acid Gene 6 Homolog)
208436 100 µg

STRA6 (Stimulated by Retinoic acid Gene 6 Homolog (mouse), FLJ12541, MCOPS9, PP14296, Stimulated by Retinoic acid Gene 6 Homolog)

Sign In for Pricing
View Details
C4orf29 Double Nickase Plasmid (h2)
sc-413351-NIC-2 20 µg

C4orf29 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Diphenyl p-Hydroxyphenyl Phosphate-d10 (major)
TRC-D492429-2.5MG 2.5 mg

Diphenyl p-Hydroxyphenyl Phosphate-d10 (major)

Sign In for Pricing
View Details
PROCR Mouse Monoclonal Antibody [Clone ID: OTI12C4]
CF805779 100 µg

PROCR Mouse Monoclonal Antibody [Clone ID: OTI12C4]

Sign In for Pricing
View Details
LOC299277 3'UTR GFP Stable Cell Line
TU259883 1.0 mL

LOC299277 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details