BLNK, Human (His)
BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors[1].
Product Specifications
Product Name Alternative
BLNK Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/blnk-protein-human-his.html
Smiles
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSHHHHHH
Molecular Formula
29760 (Gene_ID) AAH18906 (M1-S456) (Accession)
Molecular Weight
Approximately 40-80 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Soini L, et al. A biophysical and structural analysis of the interaction of BLNK with 14-3-3 proteins. J Struct Biol. 2020;212 (3) :107662.|[2]Taguchi T, et al. Deficiency of BLNK hampers PLC-gamma2 phosphorylation and Ca2+ influx induced by the pre-B-cell receptor in human pre-B cells. Immunology. 2004;112 (4) :575-582.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]](https://cdn.genprice.uk/products/763/68dd14ad061270361e7d331a/imageurl/e-ab-f1351d.webp)
E-AB-F1351D-03 2x 100 Tests
PE Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
Sign In for Pricing
View Details 
