Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH1A2, Human (His)

ALDH1A2 Protein, Human (His) is a human recombinant ALDH1A2 with a N-terminal His tag produced in E. coli. ALDH1A2 Protein, Human (His) expresses the target gene encoding Met1-Ser518.

Product Specifications

Product Name Alternative

ALDH1A2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aldh1a2-protein-human-his.html

Purity

98.0

Smiles

MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS

Molecular Formula

8854 (Gene_ID) O94788-1 (M1-S518) (Accession)

Molecular Weight

Approximately 55-65 kDa

References & Citations

[1]Choi JA, et al. ALDH1A2 Is a Candidate Tumor Suppressor Gene in Ovarian Cancer. Cancers (Basel) . 2019 Oct 14;11 (10) . pii: E1553.|[2]Wang Y, et al. ALDH1A2 suppresses epithelial ovarian cancer cell proliferation and migration by downregulating STAT3. Onco Targets Ther. 2018 Jan 31;11:599-608.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PHF2 Knockout A549 Polyclonal Cells
ARG10006 1 Million

PHF2 Knockout A549 Polyclonal Cells

Ask
View Details
Recombinant Human Aspartyl Aminopeptidase Protein - (Dry Ice)
H00023549-P01-10ug 10 µg

Recombinant Human Aspartyl Aminopeptidase Protein - (Dry Ice)

Ask
View Details
UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody
MBS9450813-01 0.1 mL (Biotin)

UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody

Ask
View Details
UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody
MBS9450813-02 0.1 mL (AF350)

UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody

Ask
View Details
UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody
MBS9450813-03 0.1 mL (AF405)

UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody

Ask
View Details
UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody
MBS9450813-04 0.1 mL (AF488)

UV excision Repair Protein RAD23 Homolog A Polyclonal Conjugated Antibody

Ask
View Details