TXNDC12, Human (HEK293, His)
The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
TXNDC12 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html
Smiles
HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL
Molecular Formula
51060 (Gene_ID) O95881 (H27-L168) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
EIF2AK2, Control Peptide (PKR, PRKR, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, Interferon-inducible RNA-dependent Protein Kinase, P1/eIF-2A Protein Kinase, Protein Kinase RNA-activated, Tyrosine-protein Kinase EIF2AK2, p68 Kinase, MGC126524)
