Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38789156 3x 1.0 µg DNA

REEP5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Sgcb 3'UTR Lenti-reporter-Luc Vector
43620086 1.0 µg

Sgcb 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (HRP)
127047-HRP 100 µL

FZD7 (Frizzled-7, Fz-7, hFz7, FzE3) (HRP)

Sign In for Pricing
View Details
Vom1r55 Protein Vector (Rat) (pPB-N-His)
PV315487 500 ng

Vom1r55 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Siglec 5, NT (Sialic Acid-binding Ig-like Lectin 5, Siglec 5, Obesity-binding Protein 2, OB-binding Protein 2, OB-BP2, CD33 Antigen-like 2, CD170, CD33L2, OBBP2) (MaxLight 650) discontinued
S1013-59-ML650 100 µL

Siglec 5, NT (Sialic Acid-binding Ig-like Lectin 5, Siglec 5, Obesity-binding Protein 2, OB-binding Protein 2, OB-BP2, CD33 Antigen-like 2, CD170, CD33L2, OBBP2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/1395R) [mFluor Violet 610 SE]
NBP2-54385MFV610 0.1 mL

Rabbit Monoclonal CD31/PECAM-1 Antibody (C31/1395R) [mFluor Violet 610 SE]

Sign In for Pricing
View Details