Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-34 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40456061 1.0 µg DNA

RNU6-34 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Hexokinase 4 protein (His tag)
80R-1022S 50 ug

Hexokinase 4 protein (His tag)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-615-5p miRNA Agomir/Antagomir
AM0929 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-615-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Leucomalachite green (HRP) discontinued
L2022-09 500 µL

Leucomalachite green (HRP) discontinued

Sign In for Pricing
View Details
CD119/IFNGR1 Protein (N-His, Human)
P501437 100 µg

CD119/IFNGR1 Protein (N-His, Human)

Sign In for Pricing
View Details
Phospho-HDAC5 (Ser498) Antibody
MBS9601260-01 0.1 mL

Phospho-HDAC5 (Ser498) Antibody

Sign In for Pricing
View Details