Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP-binding cassette sub-family C member 8 (ABCC8) Rat ELISA Kit
B7315 96 Tests

ATP-binding cassette sub-family C member 8 (ABCC8) Rat ELISA Kit

Sign In for Pricing
View Details
ZDHHC2 discontinued
346539-01 100 µL

ZDHHC2 discontinued

Sign In for Pricing
View Details
ZDHHC2 discontinued
346539-02 200 µL

ZDHHC2 discontinued

Sign In for Pricing
View Details
ZNF3 (NM_001278292) Human Untagged Clone
SC335936 10 µg

ZNF3 (NM_001278292) Human Untagged Clone

Sign In for Pricing
View Details
Ogn Mouse qPCR Template Standard (NM_008760)
MK203628 1 Kit

Ogn Mouse qPCR Template Standard (NM_008760)

Sign In for Pricing
View Details
OR6Y1 Human shRNA Plasmid Kit (Locus ID 391112)
TL310710 1 Kit

OR6Y1 Human shRNA Plasmid Kit (Locus ID 391112)

Sign In for Pricing
View Details