Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp3r2 Rat shRNA Lentiviral Particle (Locus ID 29749)
TL710491V 500 µL Each

Ppp3r2 Rat shRNA Lentiviral Particle (Locus ID 29749)

Sign In for Pricing
View Details
Swine IL-2 ELISA
DIY1965S-01 1 Pack (10 Plates)

Swine IL-2 ELISA

Sign In for Pricing
View Details
Swine IL-2 ELISA
DIY1965S-02 1 Pack (20 Plates)

Swine IL-2 ELISA

Sign In for Pricing
View Details
BRIT1 (MCPH1) (NM_001172575) Human Tagged ORF Clone Lentiviral Particle
RC230280L4V 200 µL

BRIT1 (MCPH1) (NM_001172575) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HCG antibody
FNab10818 1 mg

HCG antibody

Sign In for Pricing
View Details
CCDC115 Protein Vector (Human) (pPB-N-His)
PV007786 500 ng

CCDC115 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details