Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1G1 Rabbit Polyclonal Antibody
E28PN6344 100 µL

ATP6V1G1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mrvi1 (Irag1) (NM_001105210) Rat Tagged Lenti ORF Clone
RR200094L3 10 µg

Mrvi1 (Irag1) (NM_001105210) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KIT (pY570) Antibody
abx032172-01 80 µL

KIT (pY570) Antibody

Sign In for Pricing
View Details
KIT (pY570) Antibody
abx032172-02 400 µL

KIT (pY570) Antibody

Sign In for Pricing
View Details
BOLA1 Knockout A2780 Polyclonal Cells
ARG28913 1 Million

BOLA1 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily M Member 1 (TRPM1) CLIA Kit
abx493911-01 96 Tests

Human Transient Receptor Potential Cation Channel Subfamily M Member 1 (TRPM1) CLIA Kit

Sign In for Pricing
View Details