Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKRIR AAV Vector (Mouse) (CMV)
37657104 1 µg

PRKRIR AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
COX7S Rabbit Polyclonal Antibody
JOT-AP08278-01 50ul

COX7S Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX7S Rabbit Polyclonal Antibody
JOT-AP08278-02 100ul

COX7S Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human AGTRAP Protein Lysate
MBS137024-01 0.02 mg

Human AGTRAP Protein Lysate

Sign In for Pricing
View Details
Human AGTRAP Protein Lysate
MBS137024-02 5x 0.02 mg

Human AGTRAP Protein Lysate

Sign In for Pricing
View Details
CPT2 Recombinant Antibody, PE Conjugated
bsm-52621R-PE 100 µL

CPT2 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details