Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC12, Human (HEK293, His)

The TXNDC12 protein is an important endoplasmic reticulum-localized protein disulfide bond reductase that plays a key role in promoting disulfide bond formation in client proteins. As an essential component of cellular machinery, TXNDC12 contributes to complex protein folding processes, highlighting its importance in maintaining correct protein structure and function. TXNDC12 Protein, Human (HEK293, His) is the recombinant human-derived TXNDC12 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TXNDC12 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txndc12-protein-human-hek-293-his.html

Smiles

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHL

Molecular Formula

51060 (Gene_ID) O95881 (H27-L168) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC-Transforming Protein 1 (SHC1) BioAssayTM ELISA Kit (Human)
028066 96 Tests

SHC-Transforming Protein 1 (SHC1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Gm9782 3'UTR Luciferase Stable Cell Line
TU108780 1.0 mL

Gm9782 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GUCY1A1 (NM_000856) Human Mass Spec Standard
PH306063 10 µg

GUCY1A1 (NM_000856) Human Mass Spec Standard

Sign In for Pricing
View Details
ATP5E (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, epsilon Subunit, ATPE, MGC104243)
243637 100 µg

ATP5E (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, epsilon Subunit, ATPE, MGC104243)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS541892 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ZNF768 ORF Vector (Human) (pORF)
51818011 1.0 µg DNA

ZNF768 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details