Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin-3/CALR3, Human

Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER) [1].

Product Specifications

Product Name Alternative

Calreticulin-3/CALR3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-3-protein-human.html

Smiles

TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

Molecular Formula

125972 (Gene_ID) Q96L12 (T20-L384) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yidan Liu, et al. A conserved basic residue cluster is essential for the protein quality control function of the Arabidopsis calreticulin 3. Plant Signal Behav. 2013 Apr;8 (4) :e23864.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IDE Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61379R-BF555-01 20 µL

IDE Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Ask
View Details
IDE Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61379R-BF555-02 100 µL

IDE Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Ask
View Details
Nrf2-ARE/hMAO-B/QR2 modulator 1
MF-0093534-01 1 mg

Nrf2-ARE/hMAO-B/QR2 modulator 1

Ask
View Details
Nrf2-ARE/hMAO-B/QR2 modulator 1
MF-0093534-02 5 mg

Nrf2-ARE/hMAO-B/QR2 modulator 1

Ask
View Details
Nrf2-ARE/hMAO-B/QR2 modulator 1
MF-0093534-03 1 mL - 10 mM (in DMSO)

Nrf2-ARE/hMAO-B/QR2 modulator 1

Ask
View Details
Nrf2-ARE/hMAO-B/QR2 modulator 1
MF-0093534-04 10 mg

Nrf2-ARE/hMAO-B/QR2 modulator 1

Ask
View Details