Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Calreticulin-3/CALR3, Human

Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER) [1].

Product Specifications

Product Name Alternative

Calreticulin-3/CALR3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/calreticulin-3-protein-human.html

Smiles

TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

Molecular Formula

125972 (Gene_ID) Q96L12 (T20-L384) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yidan Liu, et al. A conserved basic residue cluster is essential for the protein quality control function of the Arabidopsis calreticulin 3. Plant Signal Behav. 2013 Apr;8 (4) :e23864.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

JAK1 Polyclonal Antibody
ANT-12854-50ug 50 µg

JAK1 Polyclonal Antibody

Ask
View Details
Human POTEG Protein Lysate
MBS8417560-01 0.02 mg

Human POTEG Protein Lysate

Ask
View Details
Human POTEG Protein Lysate
MBS8417560-02 5x 0.02 mg

Human POTEG Protein Lysate

Ask
View Details
Anti-CD45RO Antibody [UCHL1], PerCP-Cy5.5-100Tests
QAB44-PCP55-100Tests 100Tests

Anti-CD45RO Antibody [UCHL1], PerCP-Cy5.5-100Tests

Ask
View Details