Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Layilin/LAYN, Rat (HEK293)

Layilin (LAYN), predicted to bind hyaluronic acid, is expected to function as a membrane integral component. Its biased expression in tissues like the spleen (RPKM 32.4) and lung (RPKM 17.5) underscores Layilin's potential roles in diverse cellular processes across various physiological contexts. Layilin/LAYN Protein, Rat (HEK293) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Layilin/LAYN Protein, Rat (HEK293), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/layilin-layn-protein-rat-hek293.html

Purity

96.00

Smiles

HLLSGDLDPRGGQRFCWEGTRRPCYRVIYFHDTSQRRNFEEAKEACMKDGGQLASIETADEQRLIENFIESLQASDGDFWIGLKRLEEKQHNSTACQDLYAWTDGSLSQFRNWYMDEPSCESEVCVVMYHQPSAPPGIGGPYMFQWNDDRCNTKKNFICKYSDDKPSTTPSLSPGGEATEPAAPILPEETLEIDTKERRE

Molecular Formula

500996 (Gene_ID) NP_001178926.1 (H25-E224) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mthfsd shRNA (UAS) - Lentiviral mouse Mthfsd shRNA (UAS, iRFP) (100)
GTR15279555 1 Vial

Lentiviral mouse Mthfsd shRNA (UAS) - Lentiviral mouse Mthfsd shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MYL3 Protein Vector (Rat) (pPM-C-His)
PV283965 500 ng

MYL3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
C11orf74, CT (C11orf74, Uncharacterized protein C11orf74, Protein HEPIS) (MaxLight 550) discontinued
032672-ML550 100 µL

C11orf74, CT (C11orf74, Uncharacterized protein C11orf74, Protein HEPIS) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Anti-Human IgG2
orb1786841-01 100 µL

Mouse Anti-Human IgG2

Sign In for Pricing
View Details
Mouse Anti-Human IgG2
orb1786841-02 500 µL

Mouse Anti-Human IgG2

Sign In for Pricing
View Details
HIF3/HIF3A Rabbit Polyclonal Antibody (PE)
orb2575062 100 µg

HIF3/HIF3A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details