Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN2, Human (His)

The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PFDN2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pfdn2-protein-human-his.html

Purity

96.90

Smiles

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

Molecular Formula

5202 (Gene_ID) Q9UHV9 (M1-S154) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRAF Interacting Protein TANK (TANK, I TRAF, ITRAF, I-TRAF, TRAF Family Member-associated NF kappa B Activator, TRAF Family Member-associated NFkB Activator, TRAF-interacting Protein, TRAF-interacting Protein TANK Isoform a, TRAF-interacting Protein TANK Isoform b, TRAF2) (Not for Export EU)
T8171-75C 50 µL

TRAF Interacting Protein TANK (TANK, I TRAF, ITRAF, I-TRAF, TRAF Family Member-associated NF kappa B Activator, TRAF Family Member-associated NFkB Activator, TRAF-interacting Protein, TRAF-interacting Protein TANK Isoform a, TRAF-interacting Protein TANK Isoform b, TRAF2) (Not for Export EU)

Ask
View Details
TSHZ2 Human Pre-designed siRNA Set A
HY-RS15149 1 Set

TSHZ2 Human Pre-designed siRNA Set A

Ask
View Details
Synaptic vesicle membrane protein VAT-1 homolog (VAT1) Human ELISA Kit
H3906 96 Tests

Synaptic vesicle membrane protein VAT-1 homolog (VAT1) Human ELISA Kit

Ask
View Details
Anti-Human CD120a/TNFRSF1A Antibody (H398), APC
MBS1583579-01 50 Tests

Anti-Human CD120a/TNFRSF1A Antibody (H398), APC

Ask
View Details
Anti-Human CD120a/TNFRSF1A Antibody (H398), APC
MBS1583579-02 100 Tests

Anti-Human CD120a/TNFRSF1A Antibody (H398), APC

Ask
View Details
Anti-Human CD120a/TNFRSF1A Antibody (H398), APC
MBS1583579-03 5x 100 Tests

Anti-Human CD120a/TNFRSF1A Antibody (H398), APC

Ask
View Details