Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN2, Human (His)

The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PFDN2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pfdn2-protein-human-his.html

Purity

96.90

Smiles

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

Molecular Formula

5202 (Gene_ID) Q9UHV9 (M1-S154) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Talin1 Antibody (93E12) [DyLight 350]
NBP2-50319UV 0.1 mL

Mouse Monoclonal Talin1 Antibody (93E12) [DyLight 350]

Ask
View Details
PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
MBS2118927-01 0.1 mL

PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Ask
View Details
PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
MBS2118927-02 0.2 mL

PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Ask
View Details
PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
MBS2118927-03 0.5 mL

PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Ask
View Details
PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
MBS2118927-04 1 mL

PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Ask
View Details
PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)
MBS2118927-05 5 mL

PE-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 25 (TNFRSF25)

Ask
View Details