Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN2, Human (His)

The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PFDN2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pfdn2-protein-human-his.html

Purity

96.90

Smiles

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

Molecular Formula

5202 (Gene_ID) Q9UHV9 (M1-S154) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-100 1x 100 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-100 1x 100 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details