ULBP1/RAET1I, Human (HEK293, His)
The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, His) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
ULBP1/RAET1I Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ulbp1-protein-human-hek-293-his.html
Purity
99.90
Smiles
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAP
Molecular Formula
80329 (Gene_ID) Q9BZM6 (G26-P215) (Accession)
Molecular Weight
26-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881037-500 1x 500 µL
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details