Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULBP1/RAET1I, Human (HEK293, His)

The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, His) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ULBP1/RAET1I Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ulbp1-protein-human-hek-293-his.html

Purity

99.90

Smiles

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAP

Molecular Formula

80329 (Gene_ID) Q9BZM6 (G26-P215) (Accession)

Molecular Weight

26-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Bat star Lamin B1 Antibody, Dylight594 Conjugate
DZ41460-Dylight594 200 µL

Anti-Bat star Lamin B1 Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
Mouse Stromal Cell Derived Factor 1 Chemiluminescent Immunoassay Kit
IMSSDF1KTC 1 Each

Mouse Stromal Cell Derived Factor 1 Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit
SL1413Ra-01 96 Tests

Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit
SL1413Ra-02 48 Tests

Rat RAR Related Orphan Receptor Alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
CHRDL1 siRNA (Mouse)
orb1839131-01 15 nmol

CHRDL1 siRNA (Mouse)

Sign In for Pricing
View Details
CHRDL1 siRNA (Mouse)
orb1839131-02 30 nmol

CHRDL1 siRNA (Mouse)

Sign In for Pricing
View Details