Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein ERGIC-53 (LMAN1), partial

Product Specifications

Product Name Alternative

ER-Golgi intermediate compartment 53 kDa protein; Gp58; Intracellular mannose-specific lectin MR60; Lectin mannose-binding 1

Abbreviation

Recombinant Human LMAN1 protein, partial

Gene Name

LMAN1

UniProt

P49257

Expression Region

31-477aa

Organism

Homo sapiens (Human)

Target Sequence

DGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Mannose-specific lectin. May recognize sugar residues of glycoproteins, glycolipids, or glycosylphosphatidyl inositol anchors and may be involved in the sorting or recycling of proteins, lipids, or both. The LMAN1-MCFD2 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

57.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-transferase A1 (GSTa1) Antibody (FITC)
abx343057-01 50 µL

Glutathione S-transferase A1 (GSTa1) Antibody (FITC)

Sign In for Pricing
View Details
Glutathione S-transferase A1 (GSTa1) Antibody (FITC)
abx343057-02 100 µL

Glutathione S-transferase A1 (GSTa1) Antibody (FITC)

Sign In for Pricing
View Details
Glutathione S-transferase A1 (GSTa1) Antibody (FITC)
abx343057-03 200 µL

Glutathione S-transferase A1 (GSTa1) Antibody (FITC)

Sign In for Pricing
View Details
Glutathione S-transferase A1 (GSTa1) Antibody (FITC)
abx343057-04 1 mL

Glutathione S-transferase A1 (GSTa1) Antibody (FITC)

Sign In for Pricing
View Details
FABP6 Antibody
E308575 200 µL

FABP6 Antibody

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Feline IgG Fc Secondary Antibody [PE]
NB7268PE 1 mL

Goat Polyclonal Goat anti-Feline IgG Fc Secondary Antibody [PE]

Sign In for Pricing
View Details