GITR, Human (HEK293, His)
GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Human (HEK293, His) is a recombinant protein with a C-terminal His label, It consists of 161 amino acids (M1-E161) and is produced in HEK293 cells.
Product Specifications
Product Name Alternative
GITR Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gitr-protein-human-hek293-his.html
Smiles
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE
Molecular Formula
8784 (Gene_ID) Q9Y5U5 (Q26-E161) (Accession)
Molecular Weight
Approximately 25.44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP44844_P050-Biotin 100 µL
CNGA4 Antibody - N-terminal region : Biotin (ARP44844_P050-Biotin)
Sign In for Pricing
View Details 
