Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Human (sf9, His)

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (sf9, His) is the recombinant human-derived Prolactin protein, expressed by Sf9 insect cells , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-human-sf9-his.html

Purity

96.00

Smiles

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Formula

5617 (Gene_ID) P01236 (L29-C227) (Accession)

Molecular Weight

Approximately 26 kDa, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 0.2mg/mL
BNUB1429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 0.2mg/mL

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF640R conjugate, 0.1mg/mL
BNC401070-100 1x 100 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF405S conjugate, 0.1mg/mL
BNC040644-100 1x 100 µL

TGFalpha (MF9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF647 conjugate, 0.1mg/mL
BNC471960-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF647 conjugate, 0.1mg/mL
BNC472554-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details