Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM8/CD66b, Human (HEK293, His)

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM8/CD66b Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam8-cd66b-protein-human-hek-293-his.html

Smiles

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH

Molecular Formula

1088 (Gene_ID) P31997 (Q35-H141) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECAM1 Antibody
MBS7130485-01 0.1 mL

PECAM1 Antibody

Sign In for Pricing
View Details
PECAM1 Antibody
MBS7130485-02 5x 0.1 mL

PECAM1 Antibody

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein CXorf66 (CXorf66), partial
MBS7081475 Inquire

Recombinant Human Uncharacterized protein CXorf66 (CXorf66), partial

Sign In for Pricing
View Details
Recombinant Human ZFYVE19 Protein - (Dry Ice)
H00084936-P01-10ug 10 µg

Recombinant Human ZFYVE19 Protein - (Dry Ice)

Sign In for Pricing
View Details
Bovine EB IgM ELISA Kit
EBE0014 96 Tests

Bovine EB IgM ELISA Kit

Sign In for Pricing
View Details
ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (MaxLight 750)
MBS6233475-01 0.1 mL

ITGA1 (Integrin alpha-1, Integrin, alpha 1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (MaxLight 750)

Sign In for Pricing
View Details