Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM8/CD66b, Human (HEK293, His)

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM8/CD66b Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam8-cd66b-protein-human-hek-293-his.html

Smiles

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH

Molecular Formula

1088 (Gene_ID) P31997 (Q35-H141) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (PE)
125296-PE 100 µL

CPT1A (Carnitine O-palmitoyltransferase 1, Liver Isoform, CPT1-L, Carnitine O-palmitoyltransferase I, Liver Isoform, CPTI-L, CPT I, Carnitine Palmitoyltransferase 1A, CPT1) (PE)

Sign In for Pricing
View Details
SMAP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44405151 3x 1.0 µg DNA

SMAP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
DNAJB6 (NM_058246) Human Tagged Lenti ORF Clone
RC200206L3 10 µg

DNAJB6 (NM_058246) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
β-casein Double Nickase Plasmid (h)
sc-402248-NIC 20 µg

β-casein Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Inhibitor mmu-miR-6906-5p AAV miRNA Vector
Amm3135300 500 ng

Inhibitor mmu-miR-6906-5p AAV miRNA Vector

Sign In for Pricing
View Details
Recombinant Human CD247, GST-tagged
CD247-10931H 25 µg

Recombinant Human CD247, GST-tagged

Sign In for Pricing
View Details