Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM8/CD66b, Human (HEK293, His)

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM8/CD66b Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam8-cd66b-protein-human-hek-293-his.html

Smiles

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH

Molecular Formula

1088 (Gene_ID) P31997 (Q35-H141) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Midkine (MK) ELISA Kit
RDR-MK-Mu-48Tests 48 Tests

Mouse Midkine (MK) ELISA Kit

Sign In for Pricing
View Details
Srf Mouse siRNA Oligo Duplex (Locus ID 20807)
SR416205 1 Kit

Srf Mouse siRNA Oligo Duplex (Locus ID 20807)

Sign In for Pricing
View Details
Claudin 8 (CLDN8) Antibody
abx005720-01 60 µL

Claudin 8 (CLDN8) Antibody

Sign In for Pricing
View Details
Claudin 8 (CLDN8) Antibody
abx005720-02 120 µL

Claudin 8 (CLDN8) Antibody

Sign In for Pricing
View Details
Claudin 8 (CLDN8) Antibody
abx005720-03 200 µL

Claudin 8 (CLDN8) Antibody

Sign In for Pricing
View Details
Recombinant Human NUP93, GST-tagged
NUP93-1420H 25 µg

Recombinant Human NUP93, GST-tagged

Sign In for Pricing
View Details