CEACAM8/CD66b, Human (HEK293, His)
CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CEACAM8/CD66b Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ceacam8-cd66b-protein-human-hek-293-his.html
Smiles
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH
Molecular Formula
1088 (Gene_ID) P31997 (Q35-H141) (Accession)
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Eukaryotic Homing Associated Cell Adhesion Molecule (HCAM)
Eukaryotic Homing Associated Cell Adhesion Molecule (HCAM)
Eukaryotic Homing Associated Cell Adhesion Molecule (HCAM)
Eukaryotic Homing Associated Cell Adhesion Molecule (HCAM)
Eukaryotic Homing Associated Cell Adhesion Molecule (HCAM)