CEACAM8/CD66b, Human (HEK293, His)
CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CEACAM8/CD66b Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ceacam8-cd66b-protein-human-hek-293-his.html
Smiles
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH
Molecular Formula
1088 (Gene_ID) P31997 (Q35-H141) (Accession)
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 650)
Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 650)
RUFY1 (NM_001040452) Human Tagged ORF Clone Lentiviral Particle
