Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCGRT, Human (HEK293, His)

The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (HEK293, His) is the recombinant human-derived FCGRT protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCGRT Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcgrt-protein-human-hek-293-his.html

Smiles

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Molecular Formula

2217 (Gene_ID) P55899 (A24-S297) (Accession)

Molecular Weight

Approximately 34.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog